VMware Workstation 7 Manual de usuario Pagina 437
- Pagina / 512
- Tabla de contenidos
- SOLUCIÓN DE PROBLEMAS
- MARCADORES
Valorado. / 5. Basado en revisión del cliente
VMware, Inc. 437
Chapter 20 Deploying ACE Packages
Change Package Lifetime Settings for a Managed Package
IfyouusetheACEManagementServer,youcanchangethepackagelifetimesettings
ordeactivateapackageimmediately.
Beforeyoubegin,makesureWorkstationisconnectedtotheACEManagementServer.
Forinformationaboutinstallingandsettinguptheserver,seetheACEManagement
ServerAdministrator’sGuide.
To change package lifetime settings for a managed package
1 SelecttheACE‐e
nabledvirtualmac
hineandchooseView>CurrentView>
Summary.
2ClickthePackagessectiontab.
3Right‐clickthepackageanddooneofthefollowing:
TochangethepackagelifetimesettingschooseProperties>Settings.
TodeactivatethepackageimmediatelychooseDeactivate.
Instance Customization on Windows Guests Only
InstancecustomizationappliesonlytoACEinstancesthathaveaWindowsguest
operatingsysteminstalled.Theinstancecustomizationprocessisbuiltaroundthe
standardMicrosoftSysprepdeploymenttools.Itprovidesthefollowingbenefits:
AutomatestheSysprepprocess(theuseoftheMicrosoftSysprepdeployment
tools).ItgivesyoubettercontrolofsomeSysprepparameters,suchascomputer
name.
AutomatesjoiningACEinstancestoadomainfromaremotesite.See“SetUpa
RemoteDomainJoin”onpage 443.
FormanagedACEinstances,theinstancecustomizationprocessontheuser’s
machinereportsthesuccessorfailureoftheprocesstotheserver.Theinformation
isavailableintheinstanceviewofWorkstation.Besidesstatus,theprocessalso
reportstheMACaddressandthenewcomputername.
- Workstation User’s Manual 1
- 2 VMware, Inc 2
- 4 VMware, Inc 4
- VMware, Inc. 5 5
- Machine 133 6
- VMware, Inc. 7 7
- 8 VMware, Inc 8
- VMware, Inc. 9 9
- 13 ConfiguringTeams 271 10
- VMware, Inc. 11 11
- Contents 11
- 12 VMware, Inc 12
- 16 ConnectingDevices 331 13
- 14 VMware, Inc 14
- VMware, Inc. 15 15
- 20 DeployingACEPackages 435 16
- 21 PocketACE 457 16
- Glossary 489 17
- Index 495 17
- 18 VMware, Inc 18
- About This Book 19
- Online and Telephone Support 20
- Support Offerings 20
- VMware Professional Services 20
- Introduction and System 21
- Requirements 21
- Overview of This Manual 22
- Host System Requirements 23
- Disk Drives 24
- Local Area Networking 25
- Host Operating System 25
- 26 VMware, Inc 26
- Linux Host Operating Systems 27
- 28 VMware, Inc 28
- Processor 29
- Chip Set 29
- Graphics 30
- IDE Drives 30
- SCSI Devices 30
- VMware, Inc. 31 31
- Ethernet Card 32
- Virtual Networking 32
- VMware, Inc. 33 33
- 34 VMware, Inc 34
- VMware, Inc. 35 35
- 36 VMware, Inc 36
- VMware, Inc. 37 37
- 38 VMware, Inc 38
- Installing and Upgrading 39
- VMware Workstation 39
- 40 VMware, Inc 40
- VMware, Inc. 41 41
- Install Workstation Silently 42
- VMware, Inc. 43 43
- 44 VMware, Inc 44
- VMware, Inc. 45 45
- 46 VMware, Inc 46
- Preparing for an Upgrade 47
- 48 VMware, Inc 48
- VMware, Inc. 49 49
- Windows Vista or Windows 7 50
- Windows Vista 50
- 52 VMware, Inc 52
- Learning Workstation 53
- /usr/bin/vmware & 54
- VMware, Inc. 55 55
- Home Page and Views 56
- Summary View button 57
- Console View 58
- Appliance View 58
- Toolbar Buttons 59
- 60 VMware, Inc 60
- VMware, Inc. 61 61
- View the Sidebar 62
- Favorites List in the Sidebar 63
- 64 VMware, Inc 64
- Check for Product Updates 65
- 66 VMware, Inc 66
- VMware, Inc. 67 67
- 68 VMware, Inc 68
- Hardware Tab 69
- Options Tab 70
- General 71
- Keyboard Shortcuts 72
- VMware, Inc. 73 73
- 74 VMware, Inc 74
- VMware, Inc. 75 75
- Running the Support Script 76
- VMware, Inc. 77 77
- 78 VMware, Inc 78
- Creating and Upgrading a 79
- 80 VMware, Inc 80
- VMware, Inc. 81 81
- 82 VMware, Inc 82
- Number of Processors 84
- Memory Allocation 85
- Network Connection Type 85
- I/O Adapter Types 86
- Disk Types 86
- VMware, Inc. 87 87
- Disk Capacity 88
- VMware, Inc. 89 89
- 90 VMware, Inc 90
- VMware, Inc. 91 91
- 92 VMware, Inc 92
- VMware, Inc. 93 93
- 94 VMware, Inc 94
- VMware, Inc. 95 95
- Upgrading 96
- VMware, Inc. 97 97
- 98 VMware, Inc 98
- VMware, Inc. 99 99
- 100 VMware, Inc 100
- Installing and Using 101
- VMware Tools 101
- VMware Tools Service 102
- VMware Device Drivers 102
- VMware User Process 103
- Installing VMware Tools 104
- VMware, Inc. 105 105
- 106 VMware, Inc 106
- VMware, Inc. 107 107
- VMware, Inc. 109 109
- 110 VMware, Inc 110
- VMware, Inc. 111 111
- 112 VMware, Inc 112
- VMware, Inc. 113 113
- Session Manager 114
- VMware Tools Update Process 115
- 116 VMware, Inc 116
- VMware, Inc. 117 117
- Uninstall VMware Tools 118
- VMware, Inc. 119 119
- Options Tab Settings 120
- Configuration File 121
- Devices Tab Settings 122
- Scripts Tab Settings 122
- Shrink Tab Settings 123
- About Tab 123
- Table 5-3. vmwtool Commands 124
- VMware, Inc. 125 125
- 126 VMware, Inc 126
- VMware, Inc. 127 127
- Machine 128
- VMware, Inc. 129 129
- String in a Startup Command 130
- VMware, Inc. 131 131
- 132 VMware, Inc 132
- Creating a Virtual Machine 133
- Another Virtual Machine 133
- 134 VMware, Inc 134
- Supported Source Machines 135
- Physical Machine Source 136
- VMware, Inc. 137 137
- Dual-Boot System Source 138
- ESX Virtual Machine Source 138
- Supported Volume Types 139
- Disk Space Allocation 139
- Full or Linked Clones 139
- Supported Destinations 140
- Network Adapters 141
- Conversion Impact on Settings 142
- VMware, Inc. 143 143
- 144 VMware, Inc 144
- VMware, Inc. 145 145
- 146 VMware, Inc 146
- Getting Started with Virtual 147
- Machines 147
- Starting a Virtual Machine 148
- VMware, Inc. 149 149
- Virtual Machine Location 150
- Shut Down a Virtual Machine 151
- 152 VMware, Inc 152
- Download Components 153
- Pausing a Virtual Machine 154
- Encrypting a Virtual Machine 155
- Restrictions on Encryption 156
- Encrypt a Virtual Machine 156
- VMware, Inc. 157 157
- Delete a Virtual Machine 158
- VMware, Inc. 159 159
- 160 VMware, Inc 160
- Enter and Exit Unity Mode 161
- Use Full Screen Mode 162
- VMware, Inc. 163 163
- 164 VMware, Inc 164
- Use Quick Switch Mode 165
- Use Exclusive Mode 165
- 166 VMware, Inc 166
- VMware, Inc. 167 167
- 168 VMware, Inc 168
- VMware, Inc. 169 169
- 170 VMware, Inc 170
- VMware, Inc. 171 171
- Configuring Video and Sound 172
- Support for Direct3D Graphics 173
- 174 VMware, Inc 174
- Configuring Sound 175
- 176 VMware, Inc 176
- VMware, Inc. 177 177
- 178 VMware, Inc 178
- VMware, Inc. 179 179
- 180 VMware, Inc 180
- VMware, Inc. 181 181
- 182 VMware, Inc 182
- VMware, Inc. 183 183
- 184 VMware, Inc 184
- VMware, Inc. 185 185
- 186 VMware, Inc 186
- Transferring Files and Text 187
- Between the Host and 187
- 188 VMware, Inc 188
- VMware, Inc. 189 189
- Using Shared Folders 190
- Set Up Shared Folders 191
- 192 VMware, Inc 192
- VMware, Inc. 193 193
- 194 VMware, Inc 194
- Viewing a Shared Folder 195
- Performance Improvements 196
- Folder Mounting 197
- Using a Mapped Drive 198
- VMware, Inc. 199 199
- 200 VMware, Inc 200
- Preserving the State of a 201
- Virtual Machine 201
- 202 VMware, Inc 202
- Using Snapshots 203
- Snapshots in a Process Tree 204
- Snapshot Relationships 204
- Snapshot Conflicts 206
- VMware, Inc. 207 207
- Snapshot Manager Overview 208
- Take a Snapshot 209
- 210 VMware, Inc 210
- Revert at Power Off 211
- 212 VMware, Inc 212
- VMware, Inc. 213 213
- Using AutoProtect Snapshots 214
- VMware, Inc. 215 215
- 216 VMware, Inc 216
- Cloning, Moving, and 217
- Sharing Virtual Machines 217
- 218 VMware, Inc 218
- Cloning a Virtual Machine 219
- Types of Clones 220
- Creating Clones 221
- 222 VMware, Inc 222
- Moving a Virtual Machine 223
- Processors 224
- VMware, Inc. 225 225
- 226 VMware, Inc 226
- Moving Linked Clones 227
- 228 VMware, Inc 228
- VMware, Inc. 229 229
- Web Server 230
- VMware, Inc. 231 231
- Start and Exit VMware Player 232
- VMware, Inc. 233 233
- 234 VMware, Inc 234
- Using Disks and Disk Drives 235
- Portability 236
- Disk Size and Files 236
- Lock Files 236
- IDE and SCSI Disk Types 237
- Physical Disks 238
- Defragment Virtual Disks 239
- Compact a Virtual Disk 240
- Expand a Virtual Disk 240
- VMware, Inc. 241 241
- 242 VMware, Inc 242
- VMware, Inc. 243 243
- 244 VMware, Inc 244
- VMware, Inc. 245 245
- 246 VMware, Inc 246
- VMware, Inc. 247 247
- 248 VMware, Inc 248
- VMware, Inc. 249 249
- 250 VMware, Inc 250
- VMware, Inc. 251 251
- 252 VMware, Inc 252
- Forafloppydrive: 253
- Legacy Virtual Disks 254
- VMware, Inc. 255 255
- 256 VMware, Inc 256
- Recording and Replaying 257
- Virtual Machine Activity 257
- 258 VMware, Inc 258
- VMware, Inc. 259 259
- 260 VMware, Inc 260
- VMware, Inc. 261 261
- 262 VMware, Inc 262
- VMware, Inc. 263 263
- Create a Recording 264
- Replay a Recording 265
- Browse a Recording 266
- VMware, Inc. 267 267
- Delete a Recording 268
- Disable Periodic Screenshots 269
- 270 VMware, Inc 270
- Configuring Teams 271
- Managing Teams 272
- VMware, Inc. 273 273
- Chapter 13 Configuring Teams 273
- Rename a Team 274
- Power Off or Close a Team 274
- Delete a Team 275
- VMware, Inc. 277 277
- 278 VMware, Inc 278
- Power On a Team 279
- Suspend or Resume a Team 279
- Working with Team Networks 280
- Create a Team LAN Segment 281
- Configure LAN Segments 281
- 282 VMware, Inc 282
- Delete a LAN Segment 283
- 284 VMware, Inc 284
- Configuring a Virtual 285
- DHCP Server 286
- Network Adapter 286
- Bridged Networking 287
- Set Up Bridged Networking 288
- VMware, Inc. 289 289
- Setting Up NAT 290
- Set Up Host-Only Networking 291
- 292 VMware, Inc 292
- VMware, Inc. 293 293
- 294 VMware, Inc 294
- Add Virtual Network Adapters 295
- 296 VMware, Inc 296
- Adapters 297
- Switches 298
- VMware, Inc. 299 299
- /usr/bin/vmware-netcfg 300
- VMware, Inc. 301 301
- 302 VMware, Inc 302
- Advanced Virtual 303
- Networking 303
- Configuration 304
- Addresses 305
- Range Address Use Example 306
- VMware, Inc. 307 307
- Avoiding MAC Address Changes 308
- VMware, Inc. 309 309
- 310 VMware, Inc 310
- Workstation 311
- DHCP and DDNS 311
- 312 VMware, Inc 312
- Set Up Using Configuration 3 313
- 314 VMware, Inc 314
- VMware, Inc. 315 315
- Using NAT 316
- DHCP on the NAT Network 317
- DNS on the NAT Network 318
- Advanced NAT Configuration 319
- 320 VMware, Inc 320
- VMware, Inc. 321 321
- 322 VMware, Inc 322
- VMware, Inc. 323 323
- Considerations for Using NAT 324
- Using NAT with NetLogon 324
- VMware, Inc. 325 325
- 326 VMware, Inc 326
- Sample Linux nat.conf File 327
- Using Samba with Workstation 328
- VMware, Inc. 329 329
- /etc/samba/smb.conf 330
- Connecting Devices 331
- 332 VMware, Inc 332
- VMware, Inc. 333 333
- Chapter 16 Connecting Devices 333
- 334 VMware, Inc 334
- Using Serial Ports 335
- 336 VMware, Inc 336
- VMware, Inc. 337 337
- 338 VMware, Inc 338
- Configuring Keyboard Features 339
- Hot Keys for Virtual Machines 340
- VMware, Inc. 341 341
- 342 VMware, Inc 342
- VMware, Inc. 343 343
- 344 VMware, Inc 344
- VMware, Inc. 345 345
- 346 VMware, Inc 346
- V-Scan Code Table 347
- 348 VMware, Inc 348
- VMware, Inc. 349 349
- 350 VMware, Inc 350
- VMware, Inc. 351 351
- 352 VMware, Inc 352
- Connecting USB Devices 353
- Connect a USB Device Manually 354
- VMware, Inc. 355 355
- 356 VMware, Inc 356
- VMware, Inc. 357 357
- 358 VMware, Inc 358
- VMware, Inc. 359 359
- Disable Smart Card Sharing 360
- VMware, Inc. 361 361
- 362 VMware, Inc 362
- VMware, Inc. 363 363
- 364 VMware, Inc 364
- VMware, Inc. 365 365
- 366 VMware, Inc 366
- Virtual Processors 367
- 368 VMware, Inc 368
- Special-Purpose 369
- Configuration Options for 369
- Windows Hosts 369
- 370 VMware, Inc 370
- VMware, Inc. 371 371
- 372 VMware, Inc 372
- Virtual Key Codes 373
- 374 VMware, Inc 374
- Computer 375
- Virtual Machine Hot Key 376
- Host Operating System Hot Key 376
- VMware, Inc. 377 377
- 378 VMware, Inc 378
- VMware, Inc. 379 379
- Guest ACPI S1 Sleep 380
- Learning the Basics of 381
- VMware ACE 381
- Key Features of VMware ACE 382
- VMware ACE Terminology 383
- Administrative Workstation 384
- VMware, Inc. 385 385
- 386 VMware, Inc 386
- VMware, Inc. 387 387
- 388 VMware, Inc 388
- Setting and Using Policies 389
- Benefits of Using Policies 390
- VMware, Inc. 391 391
- Activation Settings 392
- Authentication Settings 393
- 394 VMware, Inc 394
- VMware, Inc. 395 395
- Set Activation Limit 396
- VMware, Inc. 397 397
- 398 VMware, Inc 398
- Setting Expiration Policies 399
- 400 VMware, Inc 400
- VMware, Inc. 401 401
- 402 VMware, Inc 402
- VMware, Inc. 403 403
- 404 VMware, Inc 404
- VMware, Inc. 405 405
- Add or Edit a Network Zone 406
- VMware, Inc. 407 407
- Toaddarule,clickAdd. 408
- Change NAT Settings 409
- 410 VMware, Inc 410
- VMware, Inc. 411 411
- Setting USB Device Policies 412
- VMware, Inc. 413 413
- 414 VMware, Inc 414
- Runtime Preferences Settings 415
- Exit Behavior Settings 416
- Pocket ACE Cache Settings 417
- Setting Snapshot Policies 418
- VMware, Inc. 419 419
- Setting Kiosk Mode Policies 420
- Instances 421
- 422 VMware, Inc 422
- VMware, Inc. 423 423
- 424 VMware, Inc 424
- Examples of Policy Scripts 425
- 426 VMware, Inc 426
- VMware, Inc. 427 427
- Hosts Only 428
- VMware, Inc. 429 429
- 430 VMware, Inc 430
- VMware, Inc. 431 431
- Shortcut Key Values 432
- Sample Skin File 433
- 434 VMware, Inc 434
- Deploying ACE Packages 435
- Encryption Settings 436
- Package Lifetime Settings 436
- VMware, Inc. 437 437
- 438 VMware, Inc 438
- VMware, Inc. 439 439
- 440 VMware, Inc 440
- VMware, Inc. 441 441
- 442 VMware, Inc 442
- Set Up a Remote Domain Join 443
- 444 VMware, Inc 444
- Custom EULA Settings 445
- ACE Resources Directory 446
- Settings 448
- Creating a Package 449
- 450 VMware, Inc 450
- VMware, Inc. 451 451
- 452 VMware, Inc 452
- Use the New Package Wizard 453
- 454 VMware, Inc 454
- VMware, Inc. 455 455
- Deploy Packages 456
- Pocket ACE 457
- Use Cases for Pocket ACE 458
- Portable Device Requirements 459
- Create a Pocket ACE Package 460
- VMware, Inc. 461 461
- Chapter 21 Pocket ACE 461
- 462 VMware, Inc 462
- Run the Pocket ACE Instance 463
- 464 VMware, Inc 464
- Installing ACE Packages 465
- 466 VMware, Inc 466
- VMware, Inc. 467 467
- 468 VMware, Inc 468
- VMware-Player-i386.bundle 469
- VMware-Player-x86_64.bundle 469
- 470 VMware, Inc 470
- ./vmware-install.pl 471
- 472 VMware, Inc 472
- VMware, Inc. 473 473
- Start and Use an ACE Instance 474
- VMware, Inc. 475 475
- 476 VMware, Inc 476
- VMware, Inc. 477 477
- Install an ACE Client License 478
- Quit VMware Player 479
- Troubleshooting Tools 479
- Password Prompts 480
- Respond to Hot Fix Requests 481
- Troubleshooting Setup Issues 482
- VMware, Inc. 483 483
- 484 VMware, Inc 484
- Appendix: Workstation 485
- Command-Line Reference 485
- 486 VMware, Inc 486
- Me\Windows Me.vmx" 487
- 488 VMware, Inc 488
- Glossary 489
- G GotoSnapshot 490
- H–K host‐onlynetworking 490
- L–M LANsegment 491
- N–O nonpersistentmode 491
- P parent 491
- Q quickswitchmode 492
- R rawdisk 492
- S sharedfolder 492
- T–U team 493
- V–X virtualdisk 493
- 494 VMware, Inc 494
- Numerics 495
- 496 VMware, Inc 496
- VMware, Inc. 497 497
- 498 VMware, Inc 498
- VMware, Inc. 499 499
- 500 VMware, Inc 500
- VMware, Inc. 501 501
- 502 VMware, Inc 502
- VMware, Inc. 503 503
- 504 VMware, Inc 504
- VMware, Inc. 505 505
- 506 VMware, Inc 506
- VMware, Inc. 507 507
- 508 VMware, Inc 508
- VMware, Inc. 509 509
- 510 VMware, Inc 510
- VMware, Inc. 511 511
- 512 VMware, Inc 512
Relacionado con productos y manuales para Software de gestión de sistemas VMware Workstation 7
Software de gestión de sistemas VMware VIEW COMPOSER 2.5 - ARCHITECTURE PLANNING EN-000350-01 Especificaciones
(72 paginas)
(72 paginas)
Software de gestión de sistemas VMware VIEW COMPOSER 2.5 - ARCHITECTURE Manual de usuario
(63 paginas)
(63 paginas)
Software de gestión de sistemas VMware ESX 4.0 - GETTING STARTED UPDATE 1 Guía de instalación
(370 paginas)
(370 paginas)
Software de gestión de sistemas VMware VCENTER CONFIGURATION MANAGER FOUNDATION CHECKER 3.0 Guía de instalación
(229 paginas)
(229 paginas)
Software de gestión de sistemas VMware VSHIELD MANAGER 4.1.0 UPDATE 1 - API Manual de usuario
(162 paginas)
(162 paginas)
Software de gestión de sistemas VMware GSX Server 3 Administration Guía de instalación
(436 paginas)
(436 paginas)
Software de gestión de sistemas VMware THINAPP 4.6 - MIGRATING APPLICATIONS TECHNICAL NOTE Especificaciones
(72 paginas)
(72 paginas)
© 2020, manymanuals.es. Todos los derechos reservados | 0.053 s |
Manymanuals.com
Manymanuals.de
Manymanuals.fr
Manymanuals.it
Manymanuals.pl
Manymanuals.cz
Manymanuals.es
Manymanuals-pt.com
Comentarios a estos manuales